PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_25720
Common NameKK1_025246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 280aa    MW: 31384.5 Da    PI: 9.277
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_25720genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.81.8e-4391081100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk++rrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lq++l+ql++el++
  C.cajan_25720   9 PCAACKIQRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNAAQREDAVKSLAYEAEARLRDPVYGCVGLISILQHRLKQLQTELNH 104
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +k+e
  C.cajan_25720 105 AKSE 108
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9468109IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-439106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MSMSSSNSPC AACKIQRRKC TQECVFAPYF PPDNPQRFAY VHKVFGASNV AKLLNELNAA  60
QREDAVKSLA YEAEARLRDP VYGCVGLISI LQHRLKQLQT ELNHAKSELA SYIGPHALLP  120
PTPSPPPPPP PQQQRTFSLF PFGFHEDGPS PSHSAFNLAD HAFPHAPSHP LPLPHHQHLM  180
RSQMHPKSQT DPGMLPLFLF IKIHFFKGFY TMSEKNVKIT TSIKLEIEVT GTCFIGIKNR  240
ILIFVLLFLQ FSLLSFSCDN FAAPNQVRVS VLPIRMSLTM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-116AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581559.12e-93PREDICTED: LOB domain-containing protein 36-like
TrEMBLA0A151SDG40.0A0A151SDG4_CAJCA; LOB domain-containing protein 36
STRINGGLYMA06G11181.17e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.19e-65ASYMMETRIC LEAVES 2-like 1